DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and MYSM1

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001078956.1 Gene:MYSM1 / 114803 HGNCID:29401 Length:828 Species:Homo sapiens


Alignment Length:212 Identity:46/212 - (21%)
Similarity:80/212 - (37%) Gaps:58/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLD---MAYASEVLELNMFAYPNERVLGWFC 96
            :|:|.|.||..|....:..|...|....|...:.::|   ...|||.|.:..|:     |:||:.
Human   597 EVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQCEMDPVSQTQASETLAVRGFS-----VIGWYH 656

  Fly    97 TGKSVSRSASL--------IHDYYVRECCEGQPLHLLVDAALKNQRLS-TRLYCAV---EMGVPG 149
            :..:...:.||        ...|:.|.  ..:.:.::|....:|..|. :::.|.|   |:...|
Human   657 SHPAFDPNPSLRDIDTQAKYQSYFSRG--GAKFIGMIVSPYNRNNPLPYSQITCLVISEEISPDG 719

  Fly   150 GTK----------------GLMF--------------SLVPLE-ISNENSDLVALR----CIEKQ 179
            ..:                ||:|              |.||:: |...:|||..|:    |:.|.
Human   720 SYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRLSHSSVPMDKIFRRDSDLTCLQKLLECMRKT 784

  Fly   180 SQQQASKQM-ERFVPEL 195
            ..:..:..| |.|:.|:
Human   785 LSKVTNCFMAEEFLTEI 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 46/212 (22%)
MYSM1NP_001078956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
SANT 120..164 CDD:197842
Myb_DNA-binding 120..162 CDD:278669
SWIRM 382..461 CDD:282311
MPN_2A_DUB 571..753 CDD:163698 32/162 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 656..669 2/12 (17%)
LXXLL motif 774..778 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.