Sequence 1: | NP_610210.2 | Gene: | eIF3f2 / 35547 | FlyBaseID: | FBgn0033069 | Length: | 286 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001078956.1 | Gene: | MYSM1 / 114803 | HGNCID: | 29401 | Length: | 828 | Species: | Homo sapiens |
Alignment Length: | 212 | Identity: | 46/212 - (21%) |
---|---|---|---|
Similarity: | 80/212 - (37%) | Gaps: | 58/212 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 QVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLD---MAYASEVLELNMFAYPNERVLGWFC 96
Fly 97 TGKSVSRSASL--------IHDYYVRECCEGQPLHLLVDAALKNQRLS-TRLYCAV---EMGVPG 149
Fly 150 GTK----------------GLMF--------------SLVPLE-ISNENSDLVALR----CIEKQ 179
Fly 180 SQQQASKQM-ERFVPEL 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eIF3f2 | NP_610210.2 | MPN_eIF3f | 12..280 | CDD:163695 | 46/212 (22%) |
MYSM1 | NP_001078956.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
SANT | 120..164 | CDD:197842 | |||
Myb_DNA-binding | 120..162 | CDD:278669 | |||
SWIRM | 382..461 | CDD:282311 | |||
MPN_2A_DUB | 571..753 | CDD:163698 | 32/162 (20%) | ||
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 | 656..669 | 2/12 (17%) | |||
LXXLL motif | 774..778 | 1/3 (33%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |