DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f2 and COPS6

DIOPT Version :9

Sequence 1:NP_610210.2 Gene:eIF3f2 / 35547 FlyBaseID:FBgn0033069 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_006824.2 Gene:COPS6 / 10980 HGNCID:21749 Length:327 Species:Homo sapiens


Alignment Length:269 Identity:64/269 - (23%)
Similarity:119/269 - (44%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VYLKPLVFFQIIDAYDR------RPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDL 70
            |.|.|||...|.|.:.|      ||.   ||:|.|:|:.:..:||:.|.|.:  ..|:..::|.:
Human    41 VALHPLVILNISDHWIRMRSQEGRPV---QVIGALIGKQEGRNIEVMNSFEL--LSHTVEEKIII 100

  Fly    71 DMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCE--GQPLHLLVDAALKNQ 133
            |..|.....|.....:.....|||:.||.....|...:|    ::.||  ..||.|.::...|:.
Human   101 DKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVH----KQVCEIIESPLFLKLNPMTKHT 161

  Fly   134 RLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQV 198
            .|...::.:| :.:..|...::|:.:...::.|.::.:.:..:.:.: ...|.:.......|...
Human   162 DLPVSVFESV-IDIINGEATMLFAELTYTLATEEAERIGVDHVARMT-ATGSGENSTVAEHLIAQ 224

  Fly   199 VDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDMLMA 263
            ..|.:.:..|:.|:|.|:....|.:...::.:.|..||....:|:|.:|||:..|.....|:.:.
Human   225 HSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLM 289

  Fly   264 ITLSTMIKT 272
            ..|.|:.||
Human   290 AYLGTITKT 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f2NP_610210.2 MPN_eIF3f 12..280 CDD:163695 64/269 (24%)
COPS6NP_006824.2 MPN_CSN6 39..321 CDD:163694 64/269 (24%)
Interaction with Vpr 211..327 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.