DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptr and LOC110439381

DIOPT Version :9

Sequence 1:NP_001246145.1 Gene:Ptr / 35546 FlyBaseID:FBgn0262867 Length:1169 Species:Drosophila melanogaster
Sequence 2:XP_021331006.1 Gene:LOC110439381 / 110439381 -ID:- Length:261 Species:Danio rerio


Alignment Length:277 Identity:76/277 - (27%)
Similarity:130/277 - (46%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTCGISCVDKTLNKSFYHLGICIAKHPGYFIIIPVLLTLLCMTGYQQLKYQ--IDPEYLFSPIAG 63
            |.|...|:::.|:..|..||..|.:||..||::.:.:......|:..||.:  .|.|..|:|:.|
Zfish     1 MKCKTDCIERPLSLVFEKLGRLIGRHPVVFILLSLYVAAGLGAGFIFLKEREANDIEDQFTPVNG 65

  Fly    64 EGKTERAIVEQYFKVNYTHRFNVGRITRPGRFGRVIVITKDGDENMIRREVFQELRQLDNIIQNA 128
            ..|.:|.||.::|..  :..|:..|:...|.:..:|:....| ||::....|:|:..||.  |..
Zfish    66 PAKRDREIVAEHFPP--SDEFSQLRLMSEGTYASLIITDLQG-ENILTAAAFEEILALDR--QVK 125

  Fly   129 TTTYDGDTYTYKDNCARWENECFEN---DILNLDALMDDIEAGQLNLTFPFMFNPVTWDAHLFPV 190
            |..:.|:  |::..||:....|..|   ||:..:|.  ||::  :.:|:|..      |......
Zfish   126 TLQHLGN--TFEKLCAKIRGNCVSNAVLDIIRYNAA--DIDS--VTITYPIN------DKTFLGT 178

  Fly   191 FFGGTKLTEDNYVI-SVPAIQLVYFVTADTKRQDAKG-AEWEETFLRVVGNAENSGQFKHISVSY 253
            ..||.:...::.:: |..||:|.||:  |.|:  :|| |:|.|.|:....|..:..:     ||.
Zfish   179 TIGGVETQPNSSMLKSAKAIRLYYFL--DEKK--SKGNADWLEGFIEFFSNYTDQEK-----VSE 234

  Fly   254 FASRTLDHELEKNTKTV 270
            .....|.|.| .:|:|:
Zfish   235 DDREVLQHGL-THTQTI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtrNP_001246145.1 Patched 53..845 CDD:280598 61/223 (27%)
Sterol-sensing 295..442 CDD:289145
LOC110439381XP_021331006.1 Patched 54..>233 CDD:330476 54/204 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D210960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.