DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and REG4

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001152824.1 Gene:REG4 / 83998 HGNCID:22977 Length:158 Species:Homo sapiens


Alignment Length:138 Identity:34/138 - (24%)
Similarity:58/138 - (42%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRV--GAVLATVRNEEQHQLMLHYVNRKERIFG 90
            ||.|.|    |..||....    ||.:|...|...  ||.||::.:.::...:..|::..:|   
Human    35 FYHKSN----CYGYFRKLR----NWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQR--- 88

  Fly    91 NRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDN---LWHSEPCQ 152
            ::..|:|..:...|.. |.|:. |....|..||.:    ...|...|..:.::|   .|.|..|.
Human    89 SQPIWIGLHDPQKRQQ-WQWID-GAMYLYRSWSGK----SMGGNKHCAEMSSNNNFLTWSSNECN 147

  Fly   153 RKHNFICE 160
            ::.:|:|:
Human   148 KRQHFLCK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/115 (23%)
REG4NP_001152824.1 CLECT_REG-1_like 30..156 CDD:153064 34/138 (25%)
Carbohydrate-binding 98..103 0/4 (0%)
Carbohydrate-binding 135..137 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.