DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and COLEC11

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 / 78989 HGNCID:17213 Length:285 Species:Homo sapiens


Alignment Length:153 Identity:32/153 - (20%)
Similarity:56/153 - (36%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQH 75
            |.|:..|.:.:..|:...|....              .|..:.:|...|...|..|:..::|..:
Human   150 LKFIKNAVAGVRETESKIYLLVK--------------EEKRYADAQLSCQGRGGTLSMPKDEAAN 200

  Fly    76 QLMLHYVNRK--ERIFGNRTFWLGATNLVDRSYFWTWMSTGIPV-TYAQWSRREPKSDRTGQDAC 137
            .||..|:.:.  .|:|      :|..:|.....|  ..|...|: |:.:|...||.:....:| |
Human   201 GLMAAYLAQAGLARVF------IGINDLEKEGAF--VYSDHSPMRTFNKWRSGEPNNAYDEED-C 256

  Fly   138 LVLGTDNLWHSEPCQRKHNFICE 160
            :.:.....|:...|.....|:||
Human   257 VEMVASGGWNDVACHTTMYFMCE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/113 (22%)
COLEC11NP_001242914.1 Collagen 58..111 CDD:189968
CLECT_collectin_like 165..280 CDD:153061 28/138 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.