DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-22C

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:120 Identity:33/120 - (27%)
Similarity:52/120 - (43%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRS 105
            |:.:...:|.||..|:..|..:|..||.:::|.  .|.....|.||    :..:|||..:|....
  Fly   146 YYYIEKVSEKNWSTASKTCRNMGGHLADIKDEA--DLAAIKANLKE----DTHYWLGINDLDHEG 204

  Fly   106 YFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            .|.: |.||...|:.:|:...|....|..  |:.|....: :..||.....|||:
  Fly   205 KFLS-MPTGKQTTFLKWASGRPSQLDTLN--CVFLYNGEM-YDYPCHYTFRFICQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 31/110 (28%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 32/118 (27%)

Return to query results.
Submit another query.