DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Colec11

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:151 Identity:32/151 - (21%)
Similarity:56/151 - (37%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TDLTFYQKCNPLLQCNAYFSVAGFAEV------------NWLEANHVCNRVGAVLATVRNEEQHQ 76
            |:|.|.:...|     :..:|||..|.            .:.:|...|...|..|:..::|..:.
Mouse   135 TELKFIKNALP-----SPAAVAGVRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANG 194

  Fly    77 LMLHYVNRK--ERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLV 139
            ||..|:.:.  .|:|      :|..:|.....| .:.......|:.:|...||.:....:| |:.
Mouse   195 LMASYLAQAGLARVF------IGINDLEKEGAF-VYSDRSPMQTFNKWRSGEPNNAYDEED-CVE 251

  Fly   140 LGTDNLWHSEPCQRKHNFICE 160
            :.....|:...|.....|:||
Mouse   252 MVASGGWNDVACHITMYFMCE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/124 (19%)
Colec11NP_001300907.1 Collagen 48..99 CDD:460189
CLECT_collectin_like 158..273 CDD:153061 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.