DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Mbl2

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_073195.2 Gene:Mbl2 / 64668 RGDID:67380 Length:244 Species:Rattus norvegicus


Alignment Length:106 Identity:30/106 - (28%)
Similarity:48/106 - (45%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTY 119
            |..:|:.:...:||.||.|:        ||..:.......:||.|:....:.|..  .||..|.|
  Rat   147 AKALCSELQGTVATPRNAEE--------NRAIQNVAKDVAFLGITDQRTENVFED--LTGNRVRY 201

  Fly   120 AQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            ..|:..||.:..:|:: |:||.|:..|:..||......:||
  Rat   202 TNWNEGEPNNVGSGEN-CVVLLTNGKWNDVPCSDSFLVVCE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 28/104 (27%)
Mbl2NP_073195.2 Collagen 36..95 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..99
CLECT_collectin_like 132..242 CDD:153061 30/106 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.