DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and SFTPD

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD / 6441 HGNCID:10803 Length:375 Species:Homo sapiens


Alignment Length:119 Identity:33/119 - (27%)
Similarity:54/119 - (45%) Gaps:9/119 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSY 106
            |..|||.: .:.||..:|.:.|..||:.|:..::..:...|..|     |...:|..|:......
Human   265 FKTAGFVK-PFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAK-----NEAAFLSMTDSKTEGK 323

  Fly   107 FWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            | |: .||..:.|:.|:..||..| .|.:.|:.:.|:..|:...|..|...:||
Human   324 F-TY-PTGESLVYSNWAPGEPNDD-GGSEDCVEIFTNGKWNDRACGEKRLVVCE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/110 (25%)
SFTPDNP_003010.4 gly_rich_SclB <44..>220 CDD:468478
Surfac_D-trimer 224..269 CDD:286141 1/3 (33%)
CLECT_collectin_like 262..375 CDD:153061 33/119 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.