DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Clec10a

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:55/126 - (43%) Gaps:20/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRN-EEQHQLMLHYVNRKERIFGNRTFWLGATNLVDR 104
            :||.:|   ..|.||:..|....:.|..|.: .||:.|..|        .|:...|:|   |.|:
  Rat   189 WFSQSG---KPWPEADKYCQLENSNLVAVNSLAEQNFLQTH--------MGSVVTWIG---LTDQ 239

  Fly   105 SYFWTWM-STGIPVTYAQWSRREPKS----DRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            :..|.|: .|.....:..|:.::|.:    ...|.:.|....:|..|:.:.|||.:.::||
  Rat   240 NGPWRWVDGTDYEKGFTHWAPKQPDNWYGHGLGGGEDCAHFTSDGRWNDDVCQRPYRWVCE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/116 (23%)
Clec10aXP_008766090.1 Lectin_N 5..166 CDD:461106
CLECT_DC-SIGN_like 176..301 CDD:153060 32/126 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.