DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and si:ch73-86n18.1

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001038504.2 Gene:si:ch73-86n18.1 / 564061 ZFINID:ZDB-GENE-141216-19 Length:263 Species:Danio rerio


Alignment Length:144 Identity:36/144 - (25%)
Similarity:59/144 - (40%) Gaps:22/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KCNP-------LLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERI 88
            ||.|       |.:...|||   ..:::|..:...|..:|..|..:.:.|||    |.:....|.
Zfish   120 KCRPCPEDWMHLSEKCYYFS---DDKLDWQHSKESCASMGGHLTILHSHEQH----HTLEAVARN 177

  Fly    89 FGNRT--FWLGATNLVDRSYFWTWM-STGIPVTYAQWSRREPKSDRT----GQDACLVLGTDNLW 146
            .|...  ||:|.:: .:....|.|: :|.:..||.....:||.:.|:    |:|..::......|
Zfish   178 HGGMDYHFWIGLSD-TETEGVWKWVDNTVVNKTYWNEWEKEPNNHRSGGVHGEDCAVLDSRSKTW 241

  Fly   147 HSEPCQRKHNFICE 160
            ...||...:..|||
Zfish   242 FDVPCDFHYKRICE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/117 (23%)
si:ch73-86n18.1NP_001038504.2 CLECT_DC-SIGN_like 124..256 CDD:153060 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.