DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and illr4

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001035129.1 Gene:illr4 / 559737 ZFINID:ZDB-GENE-050311-5 Length:259 Species:Danio rerio


Alignment Length:177 Identity:37/177 - (20%)
Similarity:68/177 - (38%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FTIFSLPFLVIASSNINNTDLTFYQKCNPLLQC---------NAYFSVAGFAEVNWLEANHVCNR 61
            ||.||     ....:|.|.:....:..|...||         ..|:..:....::|.::...|..
Zfish    91 FTAFS-----AVLEHIYNREQNLSRALNNSAQCPEDWQYHAGKCYYFSSNTNTLDWFKSRDACIS 150

  Fly    62 VGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSY--FWTWM-STGIPVTYAQWS 123
            .|..|..:.|.::.:.::...|:.:     .:||:|   |.|:|.  .|.|: :|.:......|:
Zfish   151 DGGHLVIINNRDEQEFLMSKTNKYK-----GSFWIG---LTDKSTEGQWLWVDNTKLSTDIRYWN 207

  Fly   124 RREP------KSDRT-GQDACLVLGTD---NLWHSEPCQRKHNFICE 160
            .:||      :::.| |:|...:...:   |.|....|......|||
Zfish   208 GQEPDNWKGYRNEYTEGEDCARIEQNNWNINSWFDAFCTIAFRRICE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/123 (20%)
illr4NP_001035129.1 CLECT_DC-SIGN_like 118..255 CDD:153060 29/145 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.