DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and si:dkey-88n24.6

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001314972.1 Gene:si:dkey-88n24.6 / 555551 ZFINID:ZDB-GENE-041014-88 Length:368 Species:Danio rerio


Alignment Length:142 Identity:38/142 - (26%)
Similarity:58/142 - (40%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CNAYFSVAGFAEVN----WLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGA 98
            ||.  :..|...||    |.||...|.:....|.:|||:.::|.:..::|  :|.......|:|.
Zfish   129 CNN--TSTGLVFVNQSMTWREAQSYCRQNHIDLVSVRNQNENQQLEKFIN--DRNSSGSAVWIGL 189

  Fly    99 TNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLG--TDNLWHSEPC-QRKHNFICE 160
            ....     |.|:... ..::..|...|| ::..|.:.|.|:|  |...|...|| .|:..|:|.
Zfish   190 FRDT-----WQWLDQS-NSSFRYWYPGEP-NNYGGHEDCAVIGKNTQRGWADVPCDSRQIPFVCH 247

  Fly   161 N----VCQLNYS 168
            .    |.|.|.|
Zfish   248 EDKLIVIQQNLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 30/117 (26%)
si:dkey-88n24.6NP_001314972.1 CLECT_1 23..129 CDD:153072 38/142 (27%)
CLECT_1 136..247 CDD:153072 30/119 (25%)
CLECT 253..365 CDD:153057 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.