DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-24Db

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:124 Identity:28/124 - (22%)
Similarity:58/124 - (46%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGI 115
            :|..|...|..:|..:|.::::|:    |..::.:   ..::::|||..:| ..|..:..:::|.
  Fly   255 DWQSAVDFCRDMGGYIAAIKDQEE----LDAISAR---LDDKSYWLGINDL-QSSNTYVSVASGR 311

  Fly   116 PVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICENVCQLNYSGLDKRV 174
            .|.:..|:..||......:: |:.|....: :.:||.||.:.||:.         ||.|
  Fly   312 EVEFLNWNAGEPNHGNEDEN-CVELIRSKM-NDDPCHRKKHVICQT---------DKEV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 24/108 (22%)
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 24/108 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.