DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-29Ca

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster


Alignment Length:142 Identity:24/142 - (16%)
Similarity:56/142 - (39%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKE 86
            |...::.::|..     :.:|.:....::.|..|...|.::|..||.:.:|::          ..
  Fly   109 NKIKMSVFKKIG-----SRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKE----------LN 158

  Fly    87 RIFGNRT---FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHS 148
            .||...|   :|:...:..:....|....:|..|.:.:|   :|.......:.|:.:.::.::. 
  Fly   159 EIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKW---KPNLATNIHNHCVYINSNEMYF- 219

  Fly   149 EPCQRKHNFICE 160
            |.|...:.|.|:
  Fly   220 ENCANDNYFACQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 20/113 (18%)
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 20/113 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.