DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-24A

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:134 Identity:31/134 - (23%)
Similarity:62/134 - (46%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LQC---------NAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGN 91
            :||         :.||.:....|:|||:|...|.|:|..||:::.:::...::      |::..:
  Fly   155 VQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIV------EKLDDS 213

  Fly    92 RTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHN 156
            ::::||.........|.: .::|....|.:|...||..: ..|:.|:.: ...|.|...|..:..
  Fly   214 KSYFLGVNENTKTGDFVS-AASGKSCLYHEWGPGEPHHN-NDQERCVSI-LRKLMHVGNCTYEKR 275

  Fly   157 FICE 160
            |||:
  Fly   276 FICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/110 (24%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/120 (24%)

Return to query results.
Submit another query.