DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-30A

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:113 Identity:26/113 - (23%)
Similarity:49/113 - (43%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNR---TFWLGATNLVDRSYFWTWMS 112
            ||..|::.|.::|..:||:|:|::.          ..||...   .||:....:.....|.:.: 
  Fly   122 NWFGASNTCRQLGGHIATIRDEQEF----------NEIFSRAPAGVFWIDMNAMFKNGLFASSL- 175

  Fly   113 TGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            ||....:.:|.    |.:|..:..|:.:....: ::|.|...|.|||:
  Fly   176 TGRSPPFFKWK----KEERGNKFDCVNVYNKEM-YNENCFNTHLFICQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/111 (23%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.