DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-33A

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster


Alignment Length:180 Identity:41/180 - (22%)
Similarity:67/180 - (37%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAG-------FAEVNWLEANHVCNRVGAVLA 67
            |..||:||          ...:|.....|...||..|       ..|.||..|:..|.::||.|.
  Fly     6 SFGFLLIA----------LILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELM 60

  Fly    68 TVRNEEQHQLMLHYVNRKERIF---GNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKS 129
            .:.|:|...|...::......|   .:.:.|.|...|.:|..| .....|..|.|..|...||.:
  Fly    61 VLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTF-LLARNGETVPYLNWVPLEPNN 124

  Fly   130 DRTGQDACLVLGTDN---LWHSEPCQRKHNFICENVCQLNYSGLDKRVYI 176
            ....:| |:.....|   .:|...|:.:..::|:.....:|..|.:.:::
  Fly   125 ASPEED-CVGFANYNGAFGYHDIECKVQFPYVCQREPAEDYLCLKRDLFL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 28/116 (24%)
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.