DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Clec4f

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:116 Identity:27/116 - (23%)
Similarity:50/116 - (43%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIP 116
            |.||...|...||.||:|.::|:...::...:..:.       |:|.|:..... .|.|:. |.|
Mouse   433 WREAEKFCTSQGAHLASVTSQEEQAFLVQTTSSGDH-------WIGLTDQGTEG-IWRWVD-GTP 488

  Fly   117 VTYAQ----WSRREPKS--DRTGQ-DACLVLGTDNLWHSEPCQRKHNFICE 160
            ...||    |.:.:|.:  .|.|: :.|:.:...  |:...|...:.::|:
Mouse   489 FNNAQSKGFWGKNQPDNWRHRNGEREDCVHVRQQ--WNDMACGSSYPWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/114 (23%)
Clec4fNP_058031.2 DUF2615 <13..93 CDD:402563
SMC_prok_B <83..403 CDD:274008
CLECT_DC-SIGN_like 414..538 CDD:153060 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.