DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11211 and ly75

DIOPT Version :9

Sequence 1:	NP_610208.1	Gene:	CG11211 / 35545	FlyBaseID:	FBgn0033067	Length:	176	Species:	Drosophila melanogaster
Sequence 2:	XP_009304139.1	Gene:	ly75 / 504036	ZFINID:	ZDB-GENE-050309-166	Length:	1726	Species:	Danio rerio

Alignment Length:	141	Identity:	36/141 - (25%)
Similarity:	59/141 - (41%)	Gaps:	18/141 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 LTFYQKCNPLLQ-------CNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVN 83
            |.:.:.|:.|.:       |   :.|...|.|.|.||...|...|..|.::.:.::.|.   :.:
Zfish   209 LKYVEGCSSLWEKEPVTGRC---YQVVSTAVVTWHEARDACRSQGGDLLSLSSPQELQF---FKD 267

  Fly    84 RKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHS 148
            ||:.   ....|:|..:| |....|.| |.|.|:::|.|....|.......:.|.||.....:.:
Zfish   268 RKDL---PSKLWIGVNHL-DWMQGWQW-SDGSPLSFAPWETGIPIRSLLSDEDCGVLKESLRFGA 327

  Fly   149 EPCQRKHNFIC 159
            |.|:.:..|||
Zfish   328 ETCENRLPFIC 338

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11211	NP_610208.1	CLECT	49..160	CDD:153057	30/111 (27%)
ly75	XP_009304139.1	RICIN	37..132	CDD:214672
		FN2	160..208	CDD:128373
		CLECT	227..340	CDD:153057	33/123 (27%)
		CLECT	368..485	CDD:153057
		CLECT	499..622	CDD:214480
		CLECT	644..796	CDD:214480
		CLECT	826..931	CDD:153057
		CLECT	958..1093	CDD:214480
		CLECT	1104..1220	CDD:214480
		CLECT	1242..1359	CDD:214480
		CLECT	1399..1509	CDD:153057
		CLECT	1534..1666	CDD:214480
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910