DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11211 and Mrc2

DIOPT Version :9

Sequence 1:	NP_610208.1	Gene:	CG11211 / 35545	FlyBaseID:	FBgn0033067	Length:	176	Species:	Drosophila melanogaster
Sequence 2:	XP_006247693.1	Gene:	Mrc2 / 498011	RGDID:	1559436	Length:	1514	Species:	Rattus norvegicus

Alignment Length:	138	Identity:	40/138 - (28%)
Similarity:	62/138 - (44%)	Gaps:	19/138 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    35 LLQCNAYFSVAGFAE-VNWLEANHVCNRVGAVLATVRNEEQHQLMLHYV-NRKERIFG------- 90
            |..|...||.....| .:|:||..||..:||.|.::.:.|:.    |:| |...:|||
  Rat   713 LRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEE----HFVANMLNKIFGESEPENH 773

  Fly    91 -NRTFWLGATNLVDR-SYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNL-WHSEPCQ 152
             ...||:|......| .:.|.| |.|:..:|..::|.:...|..  ..|.||...:| |.:..||
  Rat   774 EQHWFWIGLNRRDPREGHSWRW-SDGLGFSYHNFARSQHDDDNI--RGCAVLDLASLQWVAMQCQ 835

  Fly   153 RKHNFICE 160
            .:.::||:
  Rat   836 TQLDWICK 843

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11211	NP_610208.1	CLECT	49..160	CDD:153057	35/122 (29%)
Mrc2	XP_006247693.1	RICIN	77..>161	CDD:238092
		RICIN	80..195	CDD:214672
		FN2	214..262	CDD:128373
		CLECT	281..395	CDD:153057
		CLECT	416..539	CDD:214480
		CLECT	555..678	CDD:214480
		CLECT	703..843	CDD:214480	39/136 (29%)
		CLECT	863..985	CDD:214480
		CLECT	1006..1142	CDD:214480
		CLECT	1165..1277	CDD:214480
		CLECT	1294..1427	CDD:214480
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910