DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec3b

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001011424.1 Gene:clec3b / 496907 XenbaseID:XB-GENE-945743 Length:198 Species:Xenopus tropicalis


Alignment Length:143 Identity:31/143 - (21%)
Similarity:56/143 - (39%) Gaps:27/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTFYQKCNPLLQCNAYFSVAGFAEVNWLEANH----VCNRVGAVLATVRNEEQHQLMLHYVNRKE 86
            :..|.||              |...|.|:..|    ||...|..|:|....:::..:..||  ::
 Frog    71 MKIYNKC--------------FLAFNELKTYHQASDVCFAQGGTLSTPETGDENDSLYDYV--RK 119

  Fly    87 RIFGNRTFWLGATNLVDRSYFWTWMS-TGIPVTYAQWSRR-EPKSDRTGQDACLVLGTDNL--WH 147
            .|..:...|:|..::....   ||:. ||.|:::..|... ..:.|...|:.|..|....:  |.
 Frog   120 SIGSSAEIWIGINDMATEG---TWLDLTGSPISFKHWETEITTQPDGGKQENCAALSASAIGRWF 181

  Fly   148 SEPCQRKHNFICE 160
            .:.|:.:..|:|:
 Frog   182 DKNCKTELPFVCQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/118 (22%)
clec3bNP_001011424.1 CLECT_tetranectin_like 67..195 CDD:153066 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.