DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and colec11

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001007332.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:271 Species:Danio rerio


Alignment Length:150 Identity:32/150 - (21%)
Similarity:56/150 - (37%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQH 75
            |.|:..|.:.|..||...|....              .|..:.||...|...|..||..::...:
Zfish   136 LKFIKNAVAGIKETDSKVYLLVK--------------EEKRYREAEVFCQGRGGHLAMPKDAAAN 186

  Fly    76 QLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVL 140
            :.:..||...    |....::|..:| :|...:.::......|:::|...||.:....:| |:.:
Zfish   187 RAIAGYVTDA----GLSRVYIGINDL-EREGHFVYVERSPMTTFSRWREGEPNNAYDDED-CVEM 245

  Fly   141 GTDNLWHSEPCQRKHNFICE 160
            .:...|....||....|:||
Zfish   246 VSSGEWIDVACQLTMYFVCE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/110 (21%)
colec11NP_001007332.1 gly_rich_SclB <40..>110 CDD:468478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..112
CLECT_collectin_like 151..266 CDD:153061 25/134 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.