DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and ASGR1

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:137 Identity:34/137 - (24%)
Similarity:58/137 - (42%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRS 105
            :||.:|.|   |.:|::.|....|.|..|.:.|:.:.:.|::       |....|:|   |.|::
Human   167 WFSRSGKA---WADADNYCRLEDAHLVVVTSWEEQKFVQHHI-------GPVNTWMG---LHDQN 218

  Fly   106 YFWTWM-STGIPVTYAQWSRREPKS----DRTGQDACLVLGTDNLWHSEPCQRKHNFICENVCQL 165
            ..|.|: .|.....:..|...:|..    ...|.:.|.....|..|:.:.|||.:.::||     
Human   219 GPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCE----- 278

  Fly   166 NYSGLDK 172
              :.|||
Human   279 --TELDK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/115 (22%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Lectin_N 4..144 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 154..279 CDD:153060 31/131 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.