DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and MBL2

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:123 Identity:34/123 - (27%)
Similarity:55/123 - (44%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NAYFSVAGFAEVNWLE-ANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLV 102
            |.:|...|  |:...| ...:|.:..|.:||.||..::..:.:.:  ||..|      ||.|:..
Human   136 NKFFLTNG--EIMTFEKVKALCVKFQASVATPRNAAENGAIQNLI--KEEAF------LGITDEK 190

  Fly   103 DRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            ....|..  .||..:||..|:..||.:..:.:| |::|..:..|:..||...|..:||
Human   191 TEGQFVD--LTGNRLTYTNWNEGEPNNAGSDED-CVLLLKNGQWNDVPCSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/111 (26%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113
CLECT_collectin_like 136..246 CDD:153061 34/123 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.