DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and rgn

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster


Alignment Length:120 Identity:29/120 - (24%)
Similarity:51/120 - (42%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFG-NRTFWLGATNLVDRSYFWTWMSTG 114
            :||||:..|....|.|.........:|.| ::.:::.:.| |...||||| ....:..|.|..:|
  Fly    83 SWLEAHFFCKDKNANLTEPGKHADRKLRL-FLQKQDALSGENDPIWLGAT-YDHHNNRWQWSMSG 145

  Fly   115 IPVTYAQWSRREP------KSDRTGQDACLVL--GTDNLWHSEPCQRKHNFICEN 161
            ..::...:||.:.      .:.:...:.|.:.  .....|.:.||..|..|||::
  Fly   146 RNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQH 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 28/117 (24%)
rgnNP_001246866.1 CLECT 74..200 CDD:153057 29/118 (25%)
Smc <405..>673 CDD:440809
CCDC47 <732..783 CDD:480722
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.