DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Clec3a

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001007224.1 Gene:Clec3a / 403395 MGIID:2685642 Length:196 Species:Mus musculus


Alignment Length:134 Identity:33/134 - (24%)
Similarity:54/134 - (40%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRT 93
            ::||        |.:..|..  ::.|||..|...|..|...||.::...:..|  .|..:.|...
Mouse    75 HKKC--------YLASEGLK--HYHEANEDCISKGGTLVVPRNSDEINALRDY--GKRSLPGVND 127

  Fly    94 FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVL--GTDNLWHSEPCQRKHN 156
            ||||..::|....|..  ..|..|::..|.|.:|...:  ::.|::.  .....|..|.|:....
Mouse   128 FWLGINDMVTEGKFLD--VHGFAVSFLNWDRAQPSGGK--RENCVLFSQSAQGKWSDEACRSSKR 188

  Fly   157 FICE 160
            :|||
Mouse   189 YICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/112 (24%)
Clec3aNP_001007224.1 CLECT_tetranectin_like 68..193 CDD:153066 33/134 (25%)

Return to query results.
Submit another query.