DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and CLEC17A

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:141 Identity:38/141 - (26%)
Similarity:56/141 - (39%) Gaps:26/141 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFG 90
            |.|..||       .|||.   :..:|.||...|....:.|..:.:..:|       |...:..|
Human   259 LPFEGKC-------YYFSP---STKSWDEARMFCQENYSHLVIINSFAEH-------NFVAKAHG 306

  Fly    91 N-RTFWLGATNLVDRSY--FWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQ 152
            : |.:|||   |.||:.  .|.|:. |.|||.:.|...||  :....:.|..:.....|:...|.
Human   307 SPRVYWLG---LNDRAQEGDWRWLD-GSPVTLSFWEPEEP--NNIHDEDCATMNKGGTWNDLSCY 365

  Fly   153 RKHNFICENVC 163
            :...:|||..|
Human   366 KTTYWICERKC 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 28/113 (25%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
PHA03247 <6..153 CDD:223021
CLECT_DC-SIGN_like 254..374 CDD:153060 36/137 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.