DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Clec3a

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001102369.1 Gene:Clec3a / 365009 RGDID:1306295 Length:196 Species:Rattus norvegicus


Alignment Length:134 Identity:33/134 - (24%)
Similarity:54/134 - (40%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRT 93
            ::||        |.:..|..  ::.|||..|...|..|...||.::...:..|  .|..:.|...
  Rat    75 HKKC--------YLASEGLK--HYHEANEDCISKGGTLVVPRNSDEINALRDY--SKRSLPGVND 127

  Fly    94 FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVL--GTDNLWHSEPCQRKHN 156
            ||||..::|....|..  ..|..|::..|.|.:|...:  ::.|::.  .....|..|.|:....
  Rat   128 FWLGINDMVTEGKFLD--VHGFAVSFLNWDRAQPSGGK--RENCVLFSQSAQGKWSDEACRSSKR 188

  Fly   157 FICE 160
            :|||
  Rat   189 YICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/112 (24%)
Clec3aNP_001102369.1 CLECT_tetranectin_like 68..193 CDD:153066 33/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.