DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Klrb1a

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001010964.1 Gene:Klrb1a / 362443 RGDID:1586149 Length:223 Species:Rattus norvegicus


Alignment Length:168 Identity:40/168 - (23%)
Similarity:71/168 - (42%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PFLVIASSNINNTDLTFYQKC--NPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQ 74
            |..|:...|::.|......||  :.|...:..|.|:. ..:.|.|:...|...||.|..|:::|:
  Rat    74 PCRVLIQENLSKTGSPAKLKCPKDWLSHRDKCFHVSQ-TSITWKESLADCGGKGATLLLVQDQEE 137

  Fly    75 HQLMLHYVNRKERIFGNRTFWLGAT-NLVDRSYFW----TWMSTGIPVTYAQWSRREPKSDRTGQ 134
            .:.:.   |..:||  :.:||:|.: .|.|.::.|    |..|..:.:|           ..|.:
  Rat   138 LRFLR---NLTKRI--SSSFWIGLSYTLSDENWKWINGSTLNSDVLSIT-----------GDTEK 186

  Fly   135 DACLVLGTDNLWHSEPCQRKHNFICEN----VCQLNYS 168
            |:|..:..|.:. ||.|...:.::|:.    .|..|.|
  Rat   187 DSCASVSQDKVL-SESCDSDNIWVCQKELKCECMCNDS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/115 (23%)
Klrb1aNP_001010964.1 LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 32/135 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.