Sequence 1: | NP_610208.1 | Gene: | CG11211 / 35545 | FlyBaseID: | FBgn0033067 | Length: | 176 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023952.1 | Gene: | clec-32 / 3565962 | WormBaseID: | WBGene00009860 | Length: | 365 | Species: | Caenorhabditis elegans |
Alignment Length: | 208 | Identity: | 46/208 - (22%) |
---|---|---|---|
Similarity: | 72/208 - (34%) | Gaps: | 67/208 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVN---WL---------EA 55
Fly 56 NHVC-NRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWM-STGIPVT 118
Fly 119 YAQWSRREPKSD---------------------RTGQDACLVLGTDNLWHSEPCQRKHNFICE-- 160
Fly 161 -----NVCQLNYS 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11211 | NP_610208.1 | CLECT | 49..160 | CDD:153057 | 28/145 (19%) |
clec-32 | NP_001023952.1 | CLECT | 104..232 | CDD:214480 | 31/151 (21%) |
CLECT | 249..356 | CDD:214480 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |