DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:177 Identity:40/177 - (22%)
Similarity:75/177 - (42%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIFSLPFLVIA---------SSNINNTDLTF--YQKCNPLLQCNAYFSVAGFAEVNWLEANHVCN 60
            |:..:..||||         |..:|..: ||  ..|..|..:.|..:...|...:||.||...|.
  Fly     5 TVLLITLLVIAKTGWTREKFSIQVNEGN-TFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCR 68

  Fly    61 RVGAVLATVRNEEQHQLMLHYVNRKERIFGNR-TFWLGATNLVDRSYFWTWMSTGIPVTYAQWSR 124
            .:.:.|.|...:::...:..::...    |:| |:|....:|. ::....|.:....::..:|:|
  Fly    69 ELNSELVTFETDQEFDAVTAFLTAN----GSRLTYWTSGNDLA-KTGSHRWFTNAQRISSLRWAR 128

  Fly   125 REPKSDRTGQ-DACLVLG---TDNL---WHSEPCQRKHNFICENVCQ 164
            .:|  |..|| :.|:.||   .|:.   .:..||.:..|.:.:.:|:
  Fly   129 NQP--DNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/118 (22%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.