DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and CG2839

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:120 Identity:30/120 - (25%)
Similarity:58/120 - (48%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRS 105
            :|.:....:.||.:|...|..:|..||:.:|||:    ||.:::|   ....::||..::|.|..
  Fly   156 FFYIERHVKQNWFDAMTKCREMGGHLASPQNEEE----LHLISQK---LDTESYWLDLSDLTDHG 213

  Fly   106 YFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            .:.:.:| |....:.:|::.:|  :|.......|.|  .|:.:..|..:..|||:
  Fly   214 QYISLVS-GSKAPFLKWNKGQP--NRENAQCVRVKG--GLYQTFQCDHRVLFICQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 28/110 (25%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 29/118 (25%)

Return to query results.
Submit another query.