DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and lectin-21Cb

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster


Alignment Length:145 Identity:45/145 - (31%)
Similarity:73/145 - (50%) Gaps:13/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NINNTDLTFYQKCNPLLQ--CNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYV 82
            ::.||.:....|.:|..|  .:.||.:......||.:|...|.|:|..|||.::|::     .|:
  Fly   116 SLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDE-----LYL 175

  Fly    83 NRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWH 147
            .||:  ...|.|||..:||||:..:.: ::||..|:|.:|...|||...|...|.|..|.   ::
  Fly   176 IRKQ--LEARWFWLDISNLVDKDQYIS-LATGKEVSYLKWRHGEPKKSSTANCAYLYAGD---YY 234

  Fly   148 SEPCQRKHNFICENV 162
            :..|..::.|||:.|
  Fly   235 TYQCSDRNFFICQAV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 36/110 (33%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.