powered by:
Protein Alignment CG11211 and Reg3d
DIOPT Version :9
Sequence 1: | NP_610208.1 |
Gene: | CG11211 / 35545 |
FlyBaseID: | FBgn0033067 |
Length: | 176 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_038921.2 |
Gene: | Reg3d / 30053 |
MGIID: | 1353426 |
Length: | 175 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 26/71 - (36%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 WLGATNL----VDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTD-NLWHSEPCQRK 154
|:|..:| :.....|.|.|:. |:|:..|......|...|..|.|...:. ..|....|...
Mouse 103 WIGLHDLSLGSLPNENGWKWSSSD-PLTFYNWEIPPSMSAHHGYCAALSQASGYQKWRDYYCDTI 166
Fly 155 HNFICE 160
..::|:
Mouse 167 FPYVCK 172
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11211 | NP_610208.1 |
CLECT |
49..160 |
CDD:153057 |
15/69 (22%) |
Reg3d | NP_038921.2 |
CLECT |
40..173 |
CDD:295302 |
16/71 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.