DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Sftpa1

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001257574.1 Gene:Sftpa1 / 24773 RGDID:3665 Length:258 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:49/119 - (41%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSY 106
            ||..| ..||:.....:|.|.|..:|..|..|:::.:.....:.     |...:||.  :.|::.
  Rat   149 FSTNG-QSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKY-----NNYVYLGM--IEDQTP 205

  Fly   107 FWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            .......|..|.|..|...||:..  |::.|:.:.||..|:...|.:....:||
  Rat   206 GDFHYLDGASVNYTNWYPGEPRGQ--GKEKCVEMYTDGTWNDRGCLQYRLAVCE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 24/110 (22%)
Sftpa1NP_001257574.1 Collagen 37..108 CDD:460189
CLECT_collectin_like 146..258 CDD:153061 29/119 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.