DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Cd207

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:130 Identity:27/130 - (20%)
Similarity:43/130 - (33%) Gaps:26/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWM-STGI 115
            |..|...|....|.|.:|.:|.:.:.:.       :.......|:|.|...... .|.|: .|..
Mouse   219 WYSAEQFCISRKAHLTSVSSESEQKFLY-------KAADGIPHWIGLTKAGSEG-DWYWVDQTSF 275

  Fly   116 PVTYAQ--WSRREPKSDRTGQDACLVLGTDNL--WHSEPCQRKHNFICENVCQLNYSGLDKRVYI 176
            ....::  |...|| ::....:.|..:....|  |:..||.....|||            ||.|:
Mouse   276 NKEQSRRFWIPGEP-NNAGNNEHCANIRVSALKCWNDGPCDNTFLFIC------------KRPYV 327

  Fly   177  176
            Mouse   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/112 (21%)
Cd207NP_659192.2 COG4372 65..>196 CDD:443500
CLECT_DC-SIGN_like 201..324 CDD:153060 24/125 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.