DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Asgr1

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_036635.1 Gene:Asgr1 / 24210 RGDID:2160 Length:284 Species:Rattus norvegicus


Alignment Length:115 Identity:30/115 - (26%)
Similarity:46/115 - (40%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLEANHVCNRVGAVLATVRN-EEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWM-STG 114
            |.||:..|....|.|..|.: |||..:..|        .|....|:|   |.|::..|.|: .|.
  Rat   174 WTEADKYCQLENAHLVVVTSWEEQRFVQQH--------MGPLNTWIG---LTDQNGPWKWVDGTD 227

  Fly   115 IPVTYAQWSRREPKS----DRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            ....:..|...:|..    ...|.:.|....||..|:.:.|:|.:.::||
  Rat   228 YETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 28/113 (25%)
Asgr1NP_036635.1 Lectin_N 4..143 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 153..278 CDD:153060 30/115 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.