DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec-89

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001293152.1 Gene:clec-89 / 24104193 WormBaseID:WBGene00015631 Length:324 Species:Caenorhabditis elegans


Alignment Length:121 Identity:29/121 - (23%)
Similarity:51/121 - (42%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LEANHVC------NRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWM 111
            |||::.|      :|..|:|.::.:|.::|.:::....|:..|  ...:||..........|.||
 Worm   208 LEADNKCFDYGFEHRQDAMLTSIESESENQFVMNLAKEKDANF--EFIYLGGYGRSRNGNKWHWM 270

  Fly   112 STGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLW---HSEPCQRKHNFICENVCQ 164
            . |....|..|.|..|...|.  .|.||:.....|   :::....::|.:.  ||:
 Worm   271 D-GSEFNYMNWDRGMPFGRRA--LAVLVMNKRGKWINHYADKILSQYNAVA--VCK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/115 (23%)
clec-89NP_001293152.1 CLECT 31..172 CDD:214480
CLECT 183..321 CDD:214480 28/119 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.