DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Colec10

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:157 Identity:39/157 - (24%)
Similarity:67/157 - (42%) Gaps:28/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQ 74
            |:.|:....:.|..|:..||.    ::|          .|.|:.|:...|...|.:||..::|..
Mouse   141 SMKFIKNVIAGIRETEEKFYY----IVQ----------EEKNYRESLTHCRIRGGMLAMPKDEVV 191

  Fly    75 HQLMLHYVNRKE--RIFGNRTFWLGATNLV-DRSYFWTWMSTGIPV-TYAQWSRREPKSDRTGQD 135
            :.|:..||.:..  |:|      :|..:|. :..|.:|   ...|: .|:.|...|| ||.:|.:
Mouse   192 NTLIADYVAKSGFFRVF------IGVNDLEREGQYVFT---DNTPLQNYSNWKEEEP-SDPSGHE 246

  Fly   136 ACLVLGTDNLWHSEPCQRKHNFICENV 162
            .|:.:.:...|:...|.....|:||.|
Mouse   247 DCVEMLSSGRWNDTECHLTMYFVCEFV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 29/114 (25%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 33/138 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.