DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11211 and PLA2R1

DIOPT Version :9

Sequence 1:	NP_610208.1	Gene:	CG11211 / 35545	FlyBaseID:	FBgn0033067	Length:	176	Species:	Drosophila melanogaster
Sequence 2:	NP_031392.3	Gene:	PLA2R1 / 22925	HGNCID:	9042	Length:	1463	Species:	Homo sapiens

Alignment Length:	138	Identity:	35/138 - (25%)
Similarity:	60/138 - (43%)	Gaps:	29/138 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 NWLEANHVCNRVGAVLATVRNE-EQHQLMLHYVNRKERIFGNRT-FWLGATNLVDRSYFWTWMST 113
            ||..|.|.|...|..|..:.:| ||..:.::       :||..| .|:|..|    ..:.||::
Human   983 NWTHAQHFCAEEGGTLVAIESEVEQAFITMN-------LFGQTTSVWIGLQN----DDYETWLN- 1035

  Fly   114 GIPVTYAQWSRRE----PKSDRTGQD----ACLVLGTD------NLWHSEPCQRK-HNFICENVC 163
            |.||.|:.||..:    |..:.|...    .|.:|.::      ..|:.|.|.:: :.|:||.:.
Human  1036 GKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQ 1100

  Fly   164 QLNYSGLD 171
            ..:..|::
Human  1101 DTSGHGVN 1108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11211	NP_610208.1	CLECT	49..160	CDD:153057	32/125 (26%)
PLA2R1	NP_031392.3	RICIN	39..>119	CDD:238092
		RICIN	43..151	CDD:214672
		FN2	171..219	CDD:128373
		CLECT	242..356	CDD:153057
		CLECT	378..502	CDD:214480
		CLECT	515..644	CDD:214480
		CLECT	664..797	CDD:214480
		CLECT	816..938	CDD:214480
		CLECT	958..1097	CDD:214480	32/125 (26%)
		CLECT	1116..1232	CDD:214480
		CLECT	1254..1378	CDD:214480
		Endocytosis signal	1436..1442
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S8024
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.860