DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec-129

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_494582.1 Gene:clec-129 / 189343 WormBaseID:WBGene00021145 Length:211 Species:Caenorhabditis elegans


Alignment Length:118 Identity:22/118 - (18%)
Similarity:39/118 - (33%) Gaps:44/118 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EANHVCNRVGAVLATVRNEEQ----HQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTG 114
            :|...|..||:.|:.::|..:    ...:|..:.|     .:.:.|:|                 
 Worm    68 DAEKSCKSVGSTLSGIQNRNEALYIQTALLAQIAR-----SSGSVWVG----------------- 110

  Fly   115 IPVTYAQWSRREPKSDR--------------TGQDACLVLGT--DNLWHSEPC 151
              :...|...::||||.              ||.|..:..|.  ||...::.|
 Worm   111 --MQRTQKCLKQPKSDTCSALTAFEYTDGSVTGTDGFIFQGNQPDNKELNQDC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 22/118 (19%)
clec-129NP_494582.1 CLECT 40..168 CDD:214480 22/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.