DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Pla2r1

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_032893.1 Gene:Pla2r1 / 18779 MGIID:102468 Length:1487 Species:Mus musculus


Alignment Length:162 Identity:36/162 - (22%)
Similarity:58/162 - (35%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CNPLLQ---CNAYFSVAGF--------AEVNWL-------------------EANHVCNRVGAVL 66
            |...||   |:.......|        ..|.|:                   :|:..|...|:.|
Mouse  1222 CESFLQGAICHVVTETKAFEHPGLCSETSVPWIKFKGNCYSFSTVLDSRSFEDAHEFCKSEGSNL 1286

  Fly    67 ATVRNEEQHQLMLHYVNRKERIFGN--RTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKS 129
            ..:|:..::..:|..:    ..||:  :..||.| ...:.:....|.. |.|...:.|..|:|..
Mouse  1287 LAIRDAAENSFLLEEL----LAFGSSVQMVWLNA-QFDNNNKTLRWFD-GTPTEQSNWGLRKPDM 1345

  Fly   130 DRTGQDACLVLG-TDNLWHSEPCQRKHNFICE 160
            |......|:||. .:.:||..||:.|..|||:
Mouse  1346 DHLKPHPCVVLRIPEGIWHFTPCEDKKGFICK 1377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 30/132 (23%)
Pla2r1NP_032893.1 RICIN 47..154 CDD:214672
RICIN 55..>123 CDD:238092
FN2 175..222 CDD:238019
CLECT 245..358 CDD:153057
CLECT 380..504 CDD:214480
CLECT 517..644 CDD:214480
CLECT 664..796 CDD:214480
CLECT 816..938 CDD:214480
CLECT 957..1096 CDD:214480
CLECT 1120..1231 CDD:214480 3/8 (38%)
CLECT 1253..1377 CDD:214480 29/129 (22%)
Endocytosis signal 1435..1441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1463..1487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8024
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.