DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec-225

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001021349.2 Gene:clec-225 / 181942 WormBaseID:WBGene00007152 Length:155 Species:Caenorhabditis elegans


Alignment Length:161 Identity:37/161 - (22%)
Similarity:55/161 - (34%) Gaps:43/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPLLQCNAY--FSV-----------AGFAEVNWL------------EANHVCNRVGAVLATVRNE 72
            |.|.:.|.:  |||           .||..||..            :|...|..:.|.|..::..
 Worm     2 NSLRKANFFWAFSVIGVFLAESACPVGFDLVNLKCIAITSHLLSQHKAETTCKDMNAHLIFIQTA 66

  Fly    73 EQHQLMLHYVNRKERIFGNRT--FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQD 135
            ..:..:|:|.:       |.|  .|:|||..|...........|   :|..:|...|....|...
 Worm    67 IDNTAVLNYAS-------NITSPMWIGATCKVSEEPTKCMWDDG---SYLSYSNFLPGYPVTNIG 121

  Fly   136 ACLVLGTDN-----LWHSEPCQ-RKHNFICE 160
            .|:.|.:.|     .|.|..|. .:::.|||
 Worm   122 TCVYLDSPNQPLKGRWISATCDLAEYHAICE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/130 (21%)
clec-225NP_001021349.2 CLECT 25..152 CDD:214480 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.