DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec-52

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_501371.1 Gene:clec-52 / 181855 WormBaseID:WBGene00015052 Length:308 Species:Caenorhabditis elegans


Alignment Length:164 Identity:42/164 - (25%)
Similarity:67/164 - (40%) Gaps:30/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLAT 68
            :|...||.| |:.|.....    ..||:.:.  :|...|..|    |::..|..:|..:...|.:
 Worm     6 LLVFCFSAP-LISAQCGPG----ALYQQSSS--RCLTLFRAA----VDFQTAESICATLNGHLVS 59

  Fly    69 VRNEEQHQLMLHYVNRKERIFGNRTFWLGA-------TNLVDRSYFWTWMSTGIPVTYAQWSRRE 126
            |.|...:.    :|:.:.:.|.:...||||       ||.::    |.| :.|....|..:...:
 Worm    60 VHNAIDNT----FVSGQAQKFIDGGAWLGAQASAPDVTNPLN----WYW-TDGTDFNYQNYKVGQ 115

  Fly   127 PKSDRTGQDACLVLGT-DNLWHSEPCQRKHNFIC 159
            |  .:||..||:.|.| .:.|.:..|..|..|||
 Worm   116 P--TQTGSTACMQLETGTSKWQTANCTTKLPFIC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 31/119 (26%)
clec-52NP_501371.1 CLECT 32..147 CDD:153057 32/129 (25%)
CLECT 166..303 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7663
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.