DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec-48

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_507547.1 Gene:clec-48 / 180188 WormBaseID:WBGene00007565 Length:321 Species:Caenorhabditis elegans


Alignment Length:159 Identity:39/159 - (24%)
Similarity:68/159 - (42%) Gaps:13/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTILFTIFSLPFLVIASSNINNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAV 65
            |:.:...:|.|  |..|::...||...:..:.|   :|..||:    |...:..|...||.:|..
 Worm     1 MIRLTLLLFGL--LGAATAQNCNTGGIYNSQFN---RCYQYFT----APAQFSFAEQQCNLLGGH 56

  Fly    66 LATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSD 130
            ||:|:|.:::.|:........:......:|:||.:| :.|..|.|....:...|:.|...||:| 
 Worm    57 LASVQNGQENALLQSNAANSFKKSNYSDYWIGANDL-ETSGTWKWTDPSVTFDYSNWQLGEPQS- 119

  Fly   131 RTGQDACLVLGTDNLWHSEPCQRKHNFIC 159
              |.|..:....|..|.:..|.....::|
 Worm   120 --GSDCAIQDKGDGTWSAIGCTSYRPYLC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 27/111 (24%)
clec-48NP_507547.1 CLECT 26..146 CDD:214480 31/130 (24%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7663
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000269
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.