DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Clec10a

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001423112.1 Gene:Clec10a / 17312 MGIID:96975 Length:307 Species:Mus musculus


Alignment Length:82 Identity:23/82 - (28%)
Similarity:36/82 - (43%) Gaps:13/82 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AEVNWLEANHVCNRVGAVLATVRN-EEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSYFWTWM 111
            :|.:|.||:..|....:.|..|.: |||:.|.    ||    ..|...|:|   |.|::..|.|:
Mouse   190 SEKSWPEADKYCRLENSHLVVVNSLEEQNFLQ----NR----LANVVSWIG---LTDQNGPWRWV 243

  Fly   112 -STGIPVTYAQWSRREP 127
             .|.....:..|:..:|
Mouse   244 DGTDFEKGFKNWAPLQP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 23/81 (28%)
Clec10aNP_001423112.1 Lectin_N 3..163 CDD:461106
CLECT_DC-SIGN_like 173..>267 CDD:153060 23/82 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.