DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and clec-17

DIOPT Version :9

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_493152.1 Gene:clec-17 / 173111 WormBaseID:WBGene00008477 Length:416 Species:Caenorhabditis elegans


Alignment Length:194 Identity:51/194 - (26%)
Similarity:70/194 - (36%) Gaps:64/194 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSLPFLVIASSNINNTDLTFYQKC--NPLLQCNAYFSVAGF------------AEVNWLEANHVC 59
            |:|..|:|.           ::.|  :||:..|      ||            .:||...|...|
 Worm     5 FALLLLIIC-----------FKACLNSPLICTN------GFTLLNKKCLKLFDTKVNHTSAESSC 52

  Fly    60 NRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLG--------ATNLVDRSYFWTWMSTGIP 116
            |..||.|.||:|....|.:...|.....    |..|||        |..|.|.       ::|..
 Worm    53 NSFGATLVTVKNVNDEQAIATVVAASSA----RLIWLGLYCFDSDPAKCLWDD-------NSGSA 106

  Fly   117 VTYAQWSRREPKSDRTGQDACLVLGT----DNLWHSEPCQRK-HNFICE------NVCQLNYSG 169
            .:|..:|...|..| .|.  |:.|.|    ...|.||.|:.| .::|||      :.|..||:|
 Worm   107 QSYDNFSIDFPLVD-AGH--CVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 35/123 (28%)
clec-17NP_493152.1 CLECT 24..152 CDD:214480 38/147 (26%)
CLECT 165..280 CDD:214480 2/3 (67%)
CUB 310..411 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.