DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Mbl2

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_034906.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:121 Identity:31/121 - (25%)
Similarity:56/121 - (46%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNL-VDR 104
            || |:...:::......:|:.....:||.||.|::..:       ::: .....:||.|:: |:.
Mouse   134 YF-VSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAI-------QKV-AKDIAYLGITDVRVEG 189

  Fly   105 SYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHNFICE 160
            |:   ...||..|.|..|:..||.:...|:|..::|| :..|:..||......|||
Mouse   190 SF---EDLTGNRVRYTNWNDGEPNNTGDGEDCVVILG-NGKWNDVPCSDSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/111 (23%)
Mbl2NP_034906.1 Collagen 36..93 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:470576 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.