DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11211 and Reg3a

DIOPT Version :10

Sequence 1:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_742074.2 Gene:Reg3a / 171162 RGDID:621401 Length:174 Species:Rattus norvegicus


Alignment Length:119 Identity:23/119 - (19%)
Similarity:45/119 - (37%) Gaps:15/119 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NWLEANHVC-NRVGAVLATVRNEEQHQLMLHYVNRKERIFGNRTFWLGATNLVDRSY-------F 107
            :|.:|:..| .|....|.::.:..:...:...|.  .|:..|:..|:|   |.|.:.       .
  Rat    59 SWFQADLACQKRPSGHLVSILSGGEASFVSSLVT--GRVNNNQDIWIG---LHDPTMGQQPNGGG 118

  Fly   108 WTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNL-WHSEPCQRKHNFICE 160
            |.|.::.: :.|..|......:...|....|...::.| |....|..:..|:|:
  Rat   119 WEWSNSDV-LNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11211NP_610208.1 CLECT 49..160 CDD:153057 22/117 (19%)
Reg3aNP_742074.2 CLECT 39..172 CDD:470576 23/119 (19%)
Sufficient to activate EXTL3. /evidence=ECO:0000250|UniProtKB:Q06141 102..117 4/17 (24%)

Return to query results.
Submit another query.